Brf1 Rabbit Polyclonal Antibody
CNY 4537.00
CNY 300.00
CNY 1430.00
CNY 2900.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-BRF1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PALGAEPIKPSAVLVESGPVSYHPEEDADEEDAEDEDGEPCVSALQMMGG |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 22 kDa |
Gene Name | BRF1, RNA polymerase III transcription initiation factor 90 kDa subunit |
Database Link | |
Background | BRF1 is one of the three subunits of the RNA polymerase III transcription factor complex. This complex plays a central role in transcription initiation by RNA polymerase III on genes encoding tRNA, 5S rRNA, and other small structural RNAs. |
Synonyms | BRF; BRF-1; FLJ42674; FLJ43034; GTF3B; hBRF; hTFIIIB90; MGC105048; TAF3B2; TAF3C; TAFIII90; TF3B90; TFIIIB90 |
Note | Immunogen sequence homology: Rat: 100%; Mouse: 100%; Dog: 92%; Yeast: 90%; Bovine: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |