Ddx54 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Ddx54 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ISSSYKRDLYQKWKQKQKIDDRDSEEEGPSNQRGPGPRRGGKRGRSQGTS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	98 kDa
Gene Name	DEAD (Asp-Glu-Ala-Asp) box polypeptide 54
Database Link	NP_082317 Entrez Gene 71990 Mouse UniProt ID Q8K4L0
Background	Ddx54 has RNA-dependent ATPase activity. Ddx54 represses the transcriptional activity of nuclear receptors
Synonyms	APR-5; DP97; MGC2835
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Mouse: 100%; Bovine: 100%; Human: 93%; Rabbit: 93%; Guinea pig: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.