Hsfy2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-HSFY2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EMQGEPSFQPGFPHFSSSSSTYSDSKAKGEPELPIHKERVASTTLASTSN
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	heat shock transcription factor, Y-linked 2
Database Link	NP_081937 Entrez Gene 71066 Mouse
Background	HSFY2 is Y linked hear shock transcription factor.
Synonyms	FLJ25453; HSF2-like; HSF2L; HSFY
Note	Immunogen sequence homology: Rat: 100%; Mouse: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.