Toe1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Toe1 antibody: synthetic peptide directed towards the middle region of mouse Toe1. Synthetic peptide located within the following region: QSQPGTQTLAEAEDGPPTKQVCEDSLETEKMEQKVAEGEAGDQPGSREGH
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	target of EGR1, member 1 (nuclear)
Database Link	NP_080930 Entrez Gene 68276 Mouse UniProt ID Q9D2E2
Background	Toe1 inhibits cell growth rate and cell cycle. Toe1 induces CDKN1A expression as well as TGF-beta expression.Toe1 mediates the inhibitory growth effect of EGR1.
Synonyms	FLJ13949
Note	Immunogen sequence homology: Mouse: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.