Mri1 Rabbit Polyclonal Antibody
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Mri1 antibody: synthetic peptide directed towards the N terminal of mouse 2410018C20RIK. Synthetic peptide located within the following region: LGQVAAQEAEREGATEETVRERVIRFAEDMLEKDLKDNRSIGDLGARHLL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 41 kDa |
Gene Name | methylthioribose-1-phosphate isomerase 1 |
Database Link | |
Background | This protein was disclosed by the RIKEN Mouse Gene Encyclopaedia Project, a systematic approach to determining the full coding potential of the mouse genome, involves collection and sequencing of full length complementary DNAs and physical mapping of the corresponding genes to the mouse genome. |
Synonyms | M1Pi; MGC3207; MTNA; Ypr118w |
Note | Immunogen sequence homology: Mouse: 100%; Pig: 93%; Bovine: 93%; Rat: 86%; Horse: 86%; Human: 86%; Dog: 79%; Rabbit: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |