Nmral1 Rabbit Polyclonal Antibody
CAT#: TA329936
Rabbit Polyclonal Anti-Nmral1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Mouse |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Nmral1 antibody: synthetic peptide directed towards the n terminal of mouse Nmral1. Synthetic peptide located within the following region: GATGAQGGSVARALLEDGTFRIRVVTRNPEQRAAKELKQQGAEVVRGDQD |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 34 kDa |
| Gene Name | NmrA-like family domain containing 1 |
| Database Link | |
| Background | Nmral1 is a redox sensor protein. Nmral1 undergoes restructuring and subcellular redistribution in response to changes in intracellular NADPH/NADP+ levels. At low NADPH concentrations the protein is found mainly as a monomer, and binds argininosuccinate synthase (ASS1), the enzyme involved in nitric oxide synthesis. Association with ASS1 impairs its activity and reduces the production of nitric oxide, which subsecuently prevents apoptosis. Under normal NADPH concentrations, the protein is found as a dimer and hides the binding site for ASS1. The homodimer binds one molecule of NADPH.Nmral1 has higher affinity for NADPH than for NADP+. Binding to NADPH is necessary to form a stable dimer. |
| Synonyms | FLJ25918; HSCARG; SDR48A1 |
| Note | Immunogen sequence homology: Mouse: 100%; Pig: 86%; Rat: 86%; Dog: 79%; Bovine: 79% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
