Cers4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LASS4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LVAVRIVFERFVALPLSRWMGVQDPIRRKIKPNPVLEKYFLRMKQCPEET
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	ceramide synthase 4
Database Link	NP_080334 Entrez Gene 67260 Mouse UniProt ID Q9D6J1
Background	LASS4 is a member of LASS family. Members of this family regulate (dihydro)ceramide synthases responsible for production of sphingolipids containing different fatty acids.
Synonyms	LASS4; Trh1
Note	Immunogen sequence homology: Rat: 100%; Mouse: 100%; Pig: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.