Yaf2 Rabbit Polyclonal Antibody
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-YAF2 antibody: synthetic peptide directed towards the middle region of mouse YAF2. Synthetic peptide located within the following region: GDLTVIITDFKEKAKSAPASSAAGDQHSQGSCSSDSTERGVSRSSSPRGE |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 20 kDa |
Gene Name | YY1 associated factor 2 |
Database Link | |
Background | Yaf2 binds to MYC and inhibits MYC-mediated transactivation. Yaf2 also binds to MYCN and enhances MYCN-dependent transcriptional activation. Yaf2 increases calpain 2-mediated proteolysis of YY1 in vitro. Yaf2 is a component of the E2F6.com-1 complex, a repressive complex that methylates Lys-9 of histone H3, suggesting that it is involved in chromatin-remodeling. |
Synonyms | MGC41856 |
Note | Immunogen sequence homology: Mouse: 100%; Dog: 80%; Pig: 80%; Rat: 80%; Horse: 80%; Human: 80%; Bovine: 80%; Guinea pig: 80% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |