Elp4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Elp4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FMAEGIINGHTLLVASAKENPAKILQELPAPLLDDNSKKELEDVHSAKTP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	elongator acetyltransferase complex subunit 4
Database Link	NP_076365 Entrez Gene 77766 Mouse UniProt ID Q9ER73
Background	Elp4 acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4.
Synonyms	C11orf19; dJ68P15A.1; FLJ20498; hELP4; PAX6NEB; PAXNEB
Note	Immunogen sequence homology: Mouse: 100%; Rat: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.