ZNF691 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF691 antibody: synthetic peptide directed towards the N terminal of human ZNF691. Synthetic peptide located within the following region: GSEKEQSPEPHLPEEGEGGKPWRVDDSEGSWIPPGEKEHGQESLSDELQE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	zinc finger protein 691
Database Link	NP_056995 Entrez Gene 51058 Human UniProt ID Q5VV52
Background	ZNF691 may be involved in transcriptional regulation
Synonyms	Zfp691
Note	Immunogen sequence homology: Human: 100%; Pig: 92%; Rat: 92%; Bovine: 92%; Dog: 83%; Horse: 83%; Mouse: 83%; Rabbit: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.