CHFR Rabbit Polyclonal Antibody
CNY 4628.00
CNY 4840.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommend Dilution | WB, IHC |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-CHFR antibody: synthetic peptide directed towards the N terminal of human CHFR. Synthetic peptide located within the following region: REWTIGRRRGCDLSFPSNKLVSGDHCRIVVDEKSGQVTLEDTSTSGTVIN |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 69 kDa |
| Gene Name | checkpoint with forkhead and ring finger domains, E3 ubiquitin protein ligase |
| Database Link | |
| Background | CHFR is an E3 ubiquitin-protein ligase required to transiently arrest cells in early prophase when they are exposed to microtubule poisons. It acts in early prophase before chromosome condensation, when the centrosome moves apart from each other along the periphery of the nucleus. CHFR probably promotes the formation of 'Lys-63'-linked polyubiquitin chains and functions with the specific ubiquitin-conjugating UBC13-MMS2 (UBE2N-UBE2V2) heterodimer. Substrates that are polyubiquitinated at 'Lys-63' are usually not targeted for degradation, but are rather involved in signaling cellular stress. This suggests that it may be involved in signaling the presence of mitotic stress caused by microtubule poisons. |
| Synonyms | RNF116; RNF196 |
| Note | Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Zebrafish: 86% |
| Reference Data | |
| Protein Families | Druggable Genome |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
