PRP19 (PRPF19) Rabbit Polyclonal Antibody
CAT#: TA329843
Rabbit Polyclonal Anti-PRPF19 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4537.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommend Dilution | WB, IHC |
| Reactivity | Human, Mouse |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-PRPF19 antibody: synthetic peptide directed towards the middle region of human PRPF19. Synthetic peptide located within the following region: PSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVK |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 55 kDa |
| Gene Name | pre-mRNA processing factor 19 |
| Database Link | |
| Background | PRPF19 plays a role in DNA double-strand break (DSB) repair and pre-mRNA splicing reaction. It binds double-stranded DNA in a sequence-nonspecific manner. PRPF19 acts as a structural component of the nuclear framework. It may also serve as a support for spliceosome binding and activity. It is essential for spliceosome assembly in a oligomerization-dependent manner and might also be important for spliceosome stability. It also may have E3 ubiquitin ligase activity. The PSO4 complex is required in the DNA interstrand cross-links (ICLs) repair process. Overexpression of PRPF19 might extend the cellular life span by increasing the resistance to stress or by improving the DNA repair capacity of the cells.In S. cerevisiae, Pso4 has pleiotropic functions in DNA recombination and in error-prone nonhomologous end-joining DNA repair. [supplied by OMIM] |
| Synonyms | hPSO4; NMP200; PRP19; PSO4; SNEV; UBOX4 |
| Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
| Reference Data | |
| Protein Families | Druggable Genome |
| Protein Pathways | Spliceosome, Ubiquitin mediated proteolysis |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
