C16orf73 (MEIOB) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-MEIOB antibody is: synthetic peptide directed towards the C-terminal region of Human MEIOB. Synthetic peptide located within the following region: ANILLNFIRENKETNVLDDEIDSYFKESINLSTIVDVYTVEQLKGKALKN
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	meiosis specific with OB domains
Database Link	NP_001157032 Entrez Gene 254528 Human UniProt ID Q8N635
Background	The function of this protein remains unknown.
Synonyms	C16orf73; gs129
Note	Immunogen sequence homology: Human: 100%; Horse: 93%; Dog: 86%; Pig: 86%; Mouse: 86%; Rabbit: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.