HEPACAM Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-HEPACAM antibody: synthetic peptide directed towards the N terminal of human HEPACAM. Synthetic peptide located within the following region: LLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	hepatic and glial cell adhesion molecule
Database Link	NP_689935 Entrez Gene 220296 Human UniProt ID Q14CZ8
Background	HEPACAM is involved in regulating cell motility and cell-matrix interactions. HEPACAM may inhibit cell growth through suppression of cell proliferation.
Synonyms	GlialCAM; MLC2A; MLC2B
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.