RASGEF1A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RASGEF1A antibody: synthetic peptide directed towards the N terminal of human RASGEF1A. Synthetic peptide located within the following region: TFLLSSRVFMPPHDLLARVGQICVEQKQQLEAGPEKAKLKSFSAKIVQLL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	54 kDa
Gene Name	RasGEF domain family member 1A
Database Link	NP_660356 Entrez Gene 221002 Human UniProt ID Q8N9B8
Background	RASGEF1A is the guanine nucleotide exchange factor (GEF) for KRAS, HRAS, and NRAS (in vitro). It plays a role in cell migration.
Synonyms	CG4853
Note	Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Guinea pig: 93%; Bovine: 86%; Horse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.