Mafg Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Mafg antibody is: synthetic peptide directed towards the N-terminal region of Mouse Mafg. Synthetic peptide located within the following region: TPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIIQL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	18 kDa
Gene Name	v-maf musculoaponeurotic fibrosarcoma oncogene family, protein G (avian)
Database Link	NP_034886 Entrez Gene 17134 Mouse UniProt ID O54790
Background	Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves. However, they seem to serve as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins and recruiting them to specific DNA-binding sites. Small Maf proteins heterodimerize with Fos and may act as competitive repressors of the NF-E2 transcription factor. Transcription factor, component of erythroid-specific transcription factor NF-E2. Mafg activates globin gene expression when associated with NF-E2 and may be involved in signal transduction of extracellular H+.
Synonyms	hMAF; MGC13090; MGC20149
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.