BMAL1 (ARNTL) Rabbit Polyclonal Antibody
CAT#: TA329741
Rabbit Polyclonal Anti-ARNTL Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4537.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human, Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ARNTL antibody: synthetic peptide directed towards the N terminal of human ARNTL. Synthetic peptide located within the following region: TDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSF |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 25 kDa |
Gene Name | aryl hydrocarbon receptor nuclear translocator like |
Database Link | |
Background | ARNTL is a general dimerization partner for a subset of the basic-helix-loop-helix (bHLH)-PER-ARNT-SIM (PAS) superfamily of transcriptional regulators. |
Synonyms | bHLHe5; BMAL1; BMAL1c; JAP3; MOP3; PASD3; TIC |
Note | Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 92%; Mouse: 92%; Rabbit: 92% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Circadian rhythm - mammal |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |