ZNF445 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF445 antibody: synthetic peptide directed towards the middle region of human ZNF445. Synthetic peptide located within the following region: NVEPKILTGEKRFWCQECGKTFTRKRTLLDHKGIHSGEKRYKCNLCGKSY
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	119 kDa
Gene Name	zinc finger protein 445
Database Link	NP_852466 Entrez Gene 353274 Human UniProt ID P59923
Background	ZNF445 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 14 C2H2-type zinc fingers, 1 KRAB domain and 1 SCAN box domain. ZNF445 may be involved in transcriptional regulation.
Synonyms	ZKSCAN15; ZNF168; ZSCAN47
Note	Immunogen sequence homology: Human: 100%; Dog: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Rabbit: 92%; Pig: 85%; Bovine: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.