PP14397 (JMJD8) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-JMJD8 antibody: synthetic peptide directed towards the middle region of human LOC339123. Synthetic peptide located within the following region: FGDRVVRLSTANTYSYHKVDLPFQEYVEQLLHPQDPTSLGNDTLYFFGDN
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	jumonji domain containing 8
Database Link	NP_001005920 Entrez Gene 339123 Human UniProt ID Q96S16
Background	LOC339123 is a candidate transcription factor located on chromosome 16.
Synonyms	C16orf20; PP14397
Note	Immunogen sequence homology: Human: 100%; Pig: 92%; Rat: 92%; Mouse: 92%; Dog: 85%; Horse: 85%; Guinea pig: 85%; Bovine: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.