CHX10 (VSX2) Rabbit Polyclonal Antibody
CAT#: TA329721
Rabbit Polyclonal Anti-CHX10 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CHX10 antibody: synthetic peptide directed towards the C terminal of human CHX10. Synthetic peptide located within the following region: ESILKSAKDGIMDSCAPWLLGMHKKSLEAAAESGRKPEGERQALPKLDKM |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 39 kDa |
Gene Name | visual system homeobox 2 |
Database Link | |
Background | Human CHX10 is expressed in progenitor cells of the developing neuroretina and in the inner nuclear layer of the mature retina. The strong conservation in vertebrates of the CHX10 sequence, pattern of expression and loss-of-function phenotypes demonstrates the evolutionary importance of the genetic network through which this gene regulates eye development. |
Synonyms | CHX10; HOX10; MCOP2; MCOPCB3; RET1 |
Note | Immunogen sequence homology: Human: 100%; Pig: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%; Dog: 85% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |