HCLS1 Rabbit Polyclonal Antibody
CAT#: TA329699
Rabbit Polyclonal Anti-HCLS1 Antibody
Need it in bulk or conjugated? 
                            Get a free quote
                        
CNY 4628.00
CNY 3080.00
                                                
                                                
                                                
                                                    CNY 300.00 
                                                    
                                                    CNY 1430.00
                                                
                                            
                                                
                                                
                                                
                                                    CNY 2900.00 
                                                    
                                                    CNY 6650.00
                                                
                                            
CNY 9998.00
Specifications
| Product Data | |
| Applications | IHC, WB | 
| Recommend Dilution | WB, IHC | 
| Reactivity | Human, Mouse | 
| Host | Rabbit | 
| Clonality | Polyclonal | 
| Immunogen | The immunogen for anti-HCLS1 antibody: synthetic peptide directed towards the N terminal of human HCLS1. Synthetic peptide located within the following region: VNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGP | 
| Isotype | IgG | 
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.  | 
        
| Conjugation | Unconjugated | 
| Storage Condition | Store at -20°C as received. | 
| Predicted Protein Size | 54 kDa | 
| Gene Name | hematopoietic cell-specific Lyn substrate 1 | 
| Database Link | |
| Background | HCLS1 is a substrate for caspase cleavage during apoptosis. | 
| Synonyms | CTTNL; HS1; lckBP1; p75 | 
| Note | Immunogen sequence homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86% | 
| Reference Data | |
| Protein Families | Transcription Factors | 
| Protein Pathways | Pathogenic Escherichia coli infection, Tight junction | 
Documents
| Product Manuals | 
| FAQs | 
| SDS | 
Resources
| 抗体相关资料 | 
