GTF2H4 Rabbit Polyclonal Antibody
CAT#: TA329687
Rabbit Polyclonal Anti-GTF2H4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human, Mouse |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-GTF2H4 antibody: synthetic peptide directed towards the N terminal of human GTF2H4. Synthetic peptide located within the following region: ALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIA |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 52 kDa |
| Gene Name | general transcription factor IIH subunit 4 |
| Database Link | |
| Background | GTF2H4 belongs to the TFB2 family. It is a component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. |
| Synonyms | P52; TFB2; TFIIH |
| Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 92% |
| Reference Data | |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | Basal transcription factors, Nucleotide excision repair |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
