ZMAT1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZMAT1 antibody: synthetic peptide directed towards the middle region of human ZMAT1. Synthetic peptide located within the following region: EASQTYQRPYHISPVESQLPQWLPTHSKRTYDSFQDELEDYIKVQKARGL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Database Link	NP_115817 Entrez Gene 84460 Human
Background	The function of ZMAT1 has not been determined
Synonyms	KIAA1789; matrin type 1; MGC176597; MGC176728; OTTHUMP00000023703; zinc finger
Note	Immunogen sequence homology: Horse: 100%; Human: 100%; Dog: 93%; Pig: 93%; Rat: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 86%; Mouse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.