HES7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-HES7 antibody: synthetic peptide directed towards the middle region of human HES7. Synthetic peptide located within the following region: VGYLRERSRVEPPGVPRSPVQDAKALASCYLSGFRECLLRLAAIAHDASP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	hes family bHLH transcription factor 7
Database Link	NP_115969 Entrez Gene 84667 Human UniProt ID Q9BYE0
Background	In mouse, Hes7 expression is associated with somitogenesis and is controlled by Notch signaling.
Synonyms	bHLHb37; SCDO4
Note	Immunogen sequence homology: Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.