ZNF496 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF496 antibody: synthetic peptide directed towards the middle region of human ZNF496. Synthetic peptide located within the following region: QEKPHECSVCGELFSDSEDLDGHLESHEAQKPYRCGACGKSFRLNSHLLS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	67 kDa
Gene Name	zinc finger protein 496
Database Link	NP_116141 Entrez Gene 84838 Human UniProt ID Q96IT1
Background	ZNF496 contains a SCAN box, a KRAB-A domain, and four consensus C2H2-type zinc fingers preceded by a unique finger derivative, referred to herein as the C2HR motif. The C2HR motif functions to mediate protein-protein interaction with the cysteine-rich (C5HCH) domain of NSD1 in a Zn(II)-dependent fashion, and when tethered to RNA polymerase II promoters, represses transcription in an NSD1-dependent manner. ZNF496 contains a novel type of zinc finger motif that functions as a docking site for NSD1 and is more than just a degenerate evolutionary remnant of a C2H2 motif.
Synonyms	NIZP1; ZFP496; ZKSCAN17; ZSCAN49
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Horse: 86%; Sheep: 86%; Bovine: 86%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.