FIZ1 Rabbit Polyclonal Antibody
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-FIZ1 antibody: synthetic peptide directed towards the middle region of human FIZ1. Synthetic peptide located within the following region: LAAHWAAHTDVKPFKCPRCERDFNAPALLERHKLTHDLQGPGAPPAQAWA |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 52 kDa |
Gene Name | FLT3 interacting zinc finger 1 |
Database Link | |
Background | FIZ1 is zinc finger protein, which interacts with a receptor tyrosine kinase involved in the regulation of hematopoietic and lymphoid cells. FIZ1 also interacts with a transcription factor that regulates the expression of rod-specific genes in retina. |
Synonyms | ZNF798 |
Note | Immunogen sequence homology: Pig: 100%; Human: 100%; Bovine: 100%; Dog: 86%; Rat: 79%; Mouse: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |