Tcfl5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Tcfl5 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Tcfl5. Synthetic peptide located within the following region: EKTPGGADGTRTRADGVAKEGAGGAGPDGAPEARAKPTVRVRLEDRFNSM
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	30 kDa
Gene Name	transcription factor-like 5 (basic helix-loop-helix)
Database Link	NP_839985 Entrez Gene 277353 Mouse
Background	The function of this protein remains unknown.
Synonyms	CHA; E2BP-1; E2BP1; Figlb; MGC46135
Note	Immunogen sequence homology: Rat: 100%; Mouse: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.