Tmem130 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Tmem130 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LVFLMYMTVRSAATQKDIVESPGATGLKCCCQVCCGSLFLDSPSEYLEIV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	transmembrane protein 130
Database Link	NP_808403 Entrez Gene 243339 Mouse UniProt ID Q6NXM3
Background	The function of this protein remains unknown.
Synonyms	DKFZp761L1417; FLJ42643
Note	Immunogen sequence homology: Mouse: 100%; Rat: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.