Zbtb38 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZBTB38 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EDLSDRNFSNSPGPYVVCITEKGVVKEEKNEKRHEEPAVTNGPRITNAFS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	60 kDa
Gene Name	zinc finger and BTB domain containing 38
Database Link	NP_780746 Entrez Gene 245007 Mouse
Background	ZBTB38 physically associates with CtBP via a conserved CtBP binding motif, PLDLR. When heterologously targeted to DNA, it represses transcription via two independent repression domains, an N-terminal BTB domain and a PLDLR motif-containing RD2 region, in a histone deacetylase-independent and -dependent manner, respectively
Synonyms	CIBZ; FLJ22332; FLJ31131; FLJ35036
Note	Immunogen sequence homology: Rat: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Bovine: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.