Cphx1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C330003B14RIK antibody: synthetic peptide directed towards the N terminal of mouse C330003B14RIK. Synthetic peptide located within the following region: MLSKNFPGAPETKDNRSKARKRYGSRNSKPRHKFSRDELKRLKQEFAYAP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	20 kDa
Gene Name	cytoplasmic polyadenylated homeobox 1
Database Link	NP_780551 Entrez Gene 105594 Mouse
Background	The function remains unknown.
Synonyms	AU019881; AU023336; C80129; C330003B14Rik; Cphx; Eso-1
Note	Immunogen sequence homology: Mouse: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.