Obox6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-OBOX6 antibody: synthetic peptide directed towards the middle region of mouse OBOX6. Synthetic peptide located within the following region: MALAVLVGVTANEIQIWFKNHRAKSKRESLQNVPAALPETNGSSEAVSES
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	oocyte specific homeobox 6
Database Link	NP_663756 Entrez Gene 252830 Mouse
Background	Obox6 belongs to the Obox family that represents a new family of tissue-specific homeobox genes preferentially expressed in gonads.
Synonyms	D17Ertd599e
Note	Immunogen sequence homology: Mouse: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.