PNPLA5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PNPLA5 antibody: synthetic peptide directed towards the C terminal of human PNPLA5. Synthetic peptide located within the following region: NMALEVFSRTKAQLLGPISPPATRVLETSPLQPQIAPHREELGPTHQA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	48 kDa
Gene Name	patatin like phospholipase domain containing 5
Database Link	NP_620169 Entrez Gene 150379 Human UniProt ID Q7Z6Z6
Background	Human patatin-like phospholipases, such as PNPLA5, have been implicated in regulation of adipocyte differentiation and have been induced by metabolic stimuli.Human patatin-like phospholipases, such as PNPLA5, have been implicated in regulation of adipocyte differentiation and have been induced by metabolic stimuli (Wilson et al., 2006 [PubMed 16799181]). [supplied by OMIM].Human patatin-like phospholipases, such as PNPLA5, have been implicated in regulation of adipocyte differentiation and have been induced by metabolic stimuli (Wilson et al., 2006 [PubMed 16799181]). [supplied by OMIM]
Synonyms	dJ388M5; dJ388M5.4; GS2L
Note	Immunogen sequence homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.