PNPLA5 Rabbit Polyclonal Antibody
CAT#: TA329579
Rabbit polyclonal anti-PNPLA5 antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 3080.00
CNY 4840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PNPLA5 antibody: synthetic peptide directed towards the N terminal of human PNPLA5. Synthetic peptide located within the following region: LSLSILHPAYAPIEHVKQQLQDALPPDAHVLASQRLGISLTRWPDGRNFL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 48 kDa |
Gene Name | patatin like phospholipase domain containing 5 |
Database Link | |
Background | Human patatin-like phospholipases, such as PNPLA5, have been implicated in regulation of adipocyte differentiation and have been induced by metabolic stimuli.Human patatin-like phospholipases, such as PNPLA5, have been implicated in regulation of adipocyte differentiation and have been induced by metabolic stimuli (Wilson et al., 2006 [PubMed 16799181]). [supplied by OMIM] |
Synonyms | dJ388M5; dJ388M5.4; GS2L |
Note | Immunogen sequence homology: Human: 100% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |