PAR6 (PARD6A) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PARD6A antibody: synthetic peptide directed towards the N terminal of human PARD6A. Synthetic peptide located within the following region: MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVH
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	par-6 family cell polarity regulator alpha
Database Link	NP_001032358 Entrez Gene 56513 MouseEntrez Gene 50855 Human UniProt ID Q9NPB6
Background	This gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cell membrane protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi-protein complex. The protein also has a role in the epithelial-to-mesenchymal transition (EMT) that characterizes the invasive phenotype associated with metastatic carcinomas. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Synonyms	PAR-6A; PAR6; PAR6alpha; PAR6C; TAX40; TIP-40
Note	Immunogen sequence homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%
Reference Data
Protein Families	Druggable Genome, Transcription Factors
Protein Pathways	Endocytosis, Tight junction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.