Gja10 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Gja10 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MGDWNLLGGILEEVHSHSTIVGKIWLTILFIFRMLVLGVAAEDVWDDEQS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	gap junction protein, alpha 10
Database Link	NP_034419 Entrez Gene 14610 Mouse UniProt ID Q9WUS4
Background	One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.Gja10 is ivolved in tracer coupling between horizontal cells of the retina.Gja10 may play a role in the regulation of horizontal cell patterning.
Synonyms	Connexin-62; CX62; RP11-63K6.6
Note	Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.