Alkaline Phosphatase (ALPPL2) Rabbit Polyclonal Antibody

CAT#: TA329490

Rabbit Polyclonal anti-ALPPL2 antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4537.00


货期*
2周

规格
    • 100 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of alkaline phosphatase, placental-like 2 (ALPPL2)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human alkaline phosphatase, placental-like 2 (ALPPL2), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human alkaline phosphatase, placental-like 2 (ALPPL2), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-ALPPL2 antibody: synthetic peptide directed towards the N terminal of human ALPPL2. Synthetic peptide located within the following region: MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQT
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 59 kDa
Gene Name alkaline phosphatase, placental like 2
Background There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The exact physiological function of the alkaline phosphatases is not known. ALPPL2 is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase.There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2 while the tissue non-specific form is located on chromosome 1. The exact physiological function of the alkaline phosphatases is not known. The product of this gene is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase.
Synonyms ALPG; ALPPL; GCAP
Note Immunogen sequence homology: Human: 100%; Mouse: 82%; Pig: 79%; Rat: 79%; Horse: 79%; Bovine: 79%; Dog: 77%; Rabbit: 77%; Guinea pig: 77%
Reference Data
Protein Families Druggable Genome
Protein Pathways Folate biosynthesis, Metabolic pathways
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...