C13orf8 (CHAMP1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C13ORF8 antibody: synthetic peptide directed towards the middle region of human C13ORF8. Synthetic peptide located within the following region: PAASPESRKSARTTSPEPRKPSPSESPEPWKPFPAVSPEPRRPAPAVSPG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	89 kDa
Gene Name	chromosome alignment maintaining phosphoprotein 1
Database Link	NP_115812 Entrez Gene 283489 Human UniProt ID Q96JM3
Background	The function of the C13orf8 gene has not yet been determined.
Synonyms	C13orf8; CAMP; CHAMP; ZNF828
Note	Immunogen sequence homology: Horse: 100%; Human: 100%; Dog: 93%; Rat: 93%; Rabbit: 93%; Pig: 86%; Mouse: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.