SPDEF Rabbit Polyclonal Antibody

CAT#: TA329417

Rabbit Polyclonal anti-SPDEF antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4381.00


货期*
2周

规格
    • 100 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of SAM pointed domain containing ets transcription factor (SPDEF)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human SAM pointed domain containing ets transcription factor (SPDEF), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human SAM pointed domain containing ets transcription factor (SPDEF), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-SPDEF antibody: synthetic peptide directed towards the N terminal of human SPDEF. Synthetic peptide located within the following region: AAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGA
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 38 kDa
Gene Name SAM pointed domain containing ETS transcription factor
Background PDEF is an ETS transcription factor expressed in prostate epithelial cells. It acts as an androgen-independent transactivator of PSA expression.PDEF is an ETS transcription factor expressed in prostate epithelial cells. It acts as an androgen-independent transactivator of PSA (MIM 176820) expression. [supplied by OMIM]
Synonyms bA375E1.3; PDEF
Note Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Bovine: 86%; Guinea pig: 83%
Reference Data
Protein Families Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...