PTF1A Rabbit Polyclonal Antibody
CAT#: TA329416
Rabbit Polyclonal anti-PTF1A antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PTF1A antibody: synthetic peptide directed towards the N terminal of human PTF1A. Synthetic peptide located within the following region: MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEV |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 35 kDa |
Gene Name | pancreas specific transcription factor, 1a |
Database Link | |
Background | PTF1A is a pancreas specific transcription factor. Mammalian studies have implicated important roles for the basic helix-loop-helix transcription factor PTF1A-p48 in the development of both exocrine and endocrine pancreas. |
Synonyms | bHLHa29; PACA; PAGEN2; PTF1-p48 |
Note | Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Mouse: 92%; Zebrafish: 86%; Dog: 85%; Horse: 77% |
Reference Data | |
Protein Families | Embryonic stem cells, ES Cell Differentiation/IPS |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |