ZKSCAN5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZFP95 antibody: synthetic peptide directed towards the N terminal of human ZFP95. Synthetic peptide located within the following region: MIMTESREVIDLDPPAETSQEQEDLFIVKVEEEDCTWMQEYNPPTFETFY
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	97 kDa
Gene Name	zinc finger with KRAB and SCAN domains 5
Database Link	NP_659570 Entrez Gene 23660 Human UniProt ID Q9Y2L8
Background	ZFP95 is a zinc finger protein of the Kruppel family. It contains a SCAN box and a KRAB A domain. A similar protein in mouse is differentially expressed in spermatogenesis.
Synonyms	ZFP95; ZNF914; ZSCAN37
Note	Immunogen sequence homology: Pig: 100%; Human: 100%; Dog: 92%; Horse: 92%; Guinea pig: 86%; Mouse: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.