Gsh1 (GSX1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GSX1 antibody: synthetic peptide directed towards the N terminal of human GSX1. Synthetic peptide located within the following region: MPRSFLVDSLVLREAGEKKAPEGSPPPLFPYAVPPPHALHGLSPGACHAR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	GS homeobox 1
Database Link	NP_663632 Entrez Gene 219409 Human UniProt ID Q9H4S2
Background	GSX1 is a probable transcription factor that binds to the DNA sequence 5'-GC[TA][AC]ATTA[GA]-3'. GSX1 activates the transcription of the GHRH gene. GSX1 plays an important role in pituitary development.
Synonyms	Gsh-1; GSH1
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.