EVI1 (MECOM) Rabbit Polyclonal Antibody
CNY 4628.00
CNY 4840.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-EVI1 antibody: synthetic peptide directed towards the C terminal of human EVI1. Synthetic peptide located within the following region: HFTDSLKMRKMEDNQYSEAELSSFSTSHVPEELKQPLHRKSKSQAYAMML |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 118 kDa |
Gene Name | MDS1 and EVI1 complex locus |
Database Link | |
Background | EVI1 promotes cell proliferation by interacting with BRG1 and blocking the repression of BRG1 on E2F1 activity. |
Synonyms | AML1-EVI-1; EVI1; MDS1; MDS1-EVI1; PRDM3 |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Chronic myeloid leukemia, MAPK signaling pathway, Pathways in cancer |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |