LASS3 (CERS3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LASS3 antibody: synthetic peptide directed towards the N terminal of human LASS3. Synthetic peptide located within the following region: RVFEKFVASPLAKSFGIKETVRKVTPNTVLENFFKHSTRQPLQTDIYGLA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	ceramide synthase 3
Database Link	NP_849164 Entrez Gene 204219 Human UniProt ID Q8IU89
Background	The gene encoding the hypothetical protein LASS3 is located on chromosome 15.
Synonyms	ARCI9; LASS3
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 92%; Bovine: 92%; Guinea pig: 92%; Horse: 85%; Mouse: 85%; Rat: 77%; Rabbit: 77%
Reference Data
Protein Families	Transcription Factors, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.