LASS3 (CERS3) Rabbit Polyclonal Antibody
CAT#: TA329371
Rabbit Polyclonal anti-LASS3 antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-LASS3 antibody: synthetic peptide directed towards the N terminal of human LASS3. Synthetic peptide located within the following region: RVFEKFVASPLAKSFGIKETVRKVTPNTVLENFFKHSTRQPLQTDIYGLA |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 46 kDa |
Gene Name | ceramide synthase 3 |
Database Link | |
Background | The gene encoding the hypothetical protein LASS3 is located on chromosome 15. |
Synonyms | ARCI9; LASS3 |
Note | Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 92%; Bovine: 92%; Guinea pig: 92%; Horse: 85%; Mouse: 85%; Rat: 77%; Rabbit: 77% |
Reference Data | |
Protein Families | Transcription Factors, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |