ZNF475 (ZFP1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	IHC, WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZFP1 antibody: synthetic peptide directed towards the N terminal of human ZFP1. Synthetic peptide located within the following region: SNRSYAGKQTDECNEFGKALLYLKQEKTHSGVEYSEYNKSGKALSHKAAI
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	ZFP1 zinc finger protein
Database Link	NP_710155 Entrez Gene 162239 Human UniProt ID Q6P2D0
Background	ZFP1 is part of a large family of genes present in many organisms including yeast and human. Some of them are transcriptional activators and bind specifically to DNA by zinc mediated folded structures commonly known as zinc fingers.
Synonyms	ZNF475
Note	Immunogen sequence homology: Human: 100%; Bovine: 92%; Dog: 86%; Rat: 86%; Mouse: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.