SLC34A3 Rabbit Polyclonal Antibody
CAT#: TA329337
Rabbit Polyclonal anti-SLC34A3 antibody
Need it in bulk or conjugated? 
                            Get a free quote
                        
CNY 5250.00
CNY 4840.00
                                                
                                                
                                                
                                                    CNY 300.00 
                                                    
                                                    CNY 1430.00
                                                
                                            
                                                
                                                
                                                
                                                    CNY 2900.00 
                                                    
                                                    CNY 6650.00
                                                
                                            
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB | 
| Recommend Dilution | WB | 
| Reactivity | Human | 
| Host | Rabbit | 
| Clonality | Polyclonal | 
| Immunogen | The immunogen for anti-SLC34A3 antibody: synthetic peptide directed towards the middle region of human SLC34A3. Synthetic peptide located within the following region: GDRDEFQRAFSGSAVHGIFNWLTVLVLLPLESATALLERLSELALGAASL | 
| Isotype | IgG | 
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | 
| Conjugation | Unconjugated | 
| Storage Condition | Store at -20°C as received. | 
| Predicted Protein Size | 63 kDa | 
| Gene Name | solute carrier family 34 member 3 | 
| Database Link | |
| Background | SLC34A3 contributes to the maintenance of inorganic phosphate (Pi) concentration at the kidney.SLC34A3 contributes to the maintenance of inorganic phosphate (Pi) concentration at the kidney (Segawa et al., 2002 [PubMed 11880379]). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-942 AK095999.1 1-942 943-2142 AB055000.1 827-2026 | 
| Synonyms | HHRH; NPTIIc | 
| Note | Immunogen sequence homology: Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Bovine: 86% | 
| Reference Data | |
| Protein Families | Transmembrane | 
Documents
| Product Manuals | 
| FAQs | 
| SDS | 
Resources
| 抗体相关资料 | 
其它SLC34A3产品
