POU5F2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-POU5F2 antibody: synthetic peptide directed towards the N terminal of human POU5F2. Synthetic peptide located within the following region: EFRGWIAPCRPRLGASEAGDWLRRPSEGALPGPYIALRSIPKLPPPEDIS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	POU domain class 5, transcription factor 2
Database Link	NP_694948 Entrez Gene 134187 Human UniProt ID Q8N7G0
Background	POU5F2 is a transcription factor that binds preferentially to the octamer motif (5'-ATGTTAAT-3'). It may exert a regulatory function in meiotic events that are required for terminal differentiation of male germ cell.
Synonyms	SPRM-1
Note	Immunogen sequence homology: Human: 100%; Rat: 77%; Mouse: 77%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.