POU5F2 Rabbit Polyclonal Antibody
CAT#: TA329333
Rabbit Polyclonal anti-POU5F2 antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-POU5F2 antibody: synthetic peptide directed towards the N terminal of human POU5F2. Synthetic peptide located within the following region: EFRGWIAPCRPRLGASEAGDWLRRPSEGALPGPYIALRSIPKLPPPEDIS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 36 kDa |
Gene Name | POU domain class 5, transcription factor 2 |
Database Link | |
Background | POU5F2 is a transcription factor that binds preferentially to the octamer motif (5'-ATGTTAAT-3'). It may exert a regulatory function in meiotic events that are required for terminal differentiation of male germ cell. |
Synonyms | SPRM-1 |
Note | Immunogen sequence homology: Human: 100%; Rat: 77%; Mouse: 77% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |