SALF (STON1-GTF2A1L) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SALF antibody: synthetic peptide directed towards the C terminal of human SALF. Synthetic peptide located within the following region: NSGDDVSEQDVPDLFDTDNVIVCQYDKIHRSKNKWKFYLKDGVMCFGGRD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	132 kDa
Gene Name	STON1-GTF2A1L readthrough
Database Link	NP_758515 Entrez Gene 286749 Human UniProt ID Q9Y6Q2
Background	The SALF mRNA is an infrequent but naturally occurring co-transcribed product of the neighboring SBLF and ALF genes. This rare transcript encodes a fusion protein composed of greater than 95% each of the individual elements, stoned B-like factor (SBLF) and TFIIA-alpha/beta-like factor (ALF). The significance of this co-transcribed mRNA and the function of its protein product have not yet been determined.
Synonyms	SALF
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 86%; Zebrafish: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.