RBM6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RBM6 antibody: synthetic peptide directed towards the N terminal of human RBM6. Synthetic peptide located within the following region: RNRDVSDLDFRDKDGTQVDFRGRGSGTTDLDFRDRDTPHSDFRGRHRSRT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	129 kDa
Gene Name	RNA binding motif protein 6
Database Link	NP_005768 Entrez Gene 10180 Human UniProt ID P78332
Background	RBM6 contains 1 G-patch domain and 1 RRM (RNA recognition motif) domain.It specifically binds poly(G) RNA homopolymers in vitro.
Synonyms	3G2; DEF-3; DEF3; g16; HLC-11; NY-LU-12
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rat: 93%; Guinea pig: 93%; Rabbit: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.