MXI1 Rabbit Polyclonal Antibody

CAT#: TA329266

Rabbit Polyclonal anti-MXI1 antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (2)
Transient overexpression lysate of MAX interactor 1 (MXI1), transcript variant 2
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human, Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-MXI1 antibody: synthetic peptide directed towards the middle region of human MXI1. Synthetic peptide located within the following region: LNKAKAHIKKLEEAERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRM
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 26 kDa
Gene Name MAX interactor 1, dimerization protein
Background Expression of the c-myc gene, which produces an oncogenic transcription factor, is tightly regulated in normal cells but is frequently deregulated in human cancers. The MXI1 gene encodes a transcriptional repressor protein thought to negatively regulate MYC function, and is therefore a potential tumor suppressor. This protein inhibits the transcriptional activity of MYC by competing for MAX, another basic helix-loop-helix protein that binds to MYC and is required for its function. Defects in MXI1 are frequently found in patients with prostate tumors.Expression of the c-myc gene, which produces an oncogenic transcription factor, is tightly regulated in normal cells but is frequently deregulated in human cancers. The protein encoded by this gene is a transcriptional repressor thought to negatively regulate MYC function, and is therefore a potential tumor suppressor. This protein inhibits the transcriptional activity of MYC by competing for MAX, another basic helix-loop-helix protein that binds to MYC and is required for its function. Defects in this gene are frequently found in patients with prostate tumors. Three alternatively spliced transcripts encoding different isoforms have been described. Additional alternatively spliced transcripts may exist but the products of these transcripts have not been verified experimentally.
Synonyms bHLHc11; MAD2; MXD2; MXI
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%; Yeast: 75%
Reference Data
Protein Families Druggable Genome, Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...