Hoxb1 Rabbit Polyclonal Antibody
CAT#: TA329256
Rabbit Polyclonal anti-Hoxb1 antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 2900.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Hoxb1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ETQVKIWFQNRRMKQKKREREGGRMPAGPPGCPKEAAGDASDQSACTSPE |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 31 kDa |
Gene Name | homeobox B1 |
Database Link | |
Background | Hoxb1 is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It acts on the anterior body structures. |
Synonyms | Hox-2.9; Hox-2I; HOX2; HOX2I; MGC116843; MGC116844; MGC116845 |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 90% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |